MRPL13 anticorps (Middle Region)

N° du produit ABIN632315

Détail du produit anti-MRPL13 anticorps

Antigène: MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL13 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL13 antibody was raised against the middle region of MRPL13

Purification: Affinity purified

Immunogène: MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL13 Blocking Peptide, catalog no. 33R-1286, is also available for use as a blocking control in assays to test for specificity of this MRPL13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL13

Antigène: MRPL13 (Mitochondrial Ribosomal Protein L13 (MRPL13))

Autre désignation: MRPL13 (MRPL13 Produits)

Synonymes: anticorps CG10602, anticorps CG10603, anticorps Dmel\\CG10603, anticorps L13, anticorps anon-EST:fe3C4, anticorps GB12738, anticorps MGC135435, anticorps zgc:109948, anticorps MRPL13, anticorps YK105, anticorps L13A, anticorps L13mt, anticorps RPL13, anticorps RPML13, anticorps 1110002D09Rik, anticorps mitochondrial ribosomal protein L13, anticorps 39S ribosomal protein L13, mitochondrial, anticorps mitochondrial ribosomal protein L13 S homeolog, anticorps mitochondrial 54S ribosomal protein YmL13, anticorps Putative mitochondrial ribosomal protein L13, anticorps mRpL13, anticorps LOC413928, anticorps MRPL13, anticorps mrpl13.S, anticorps mrpl13, anticorps LOC770396, anticorps mrpL13, anticorps Mrpl13

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.

Poids moléculaire: 21 kDa (MW of target protein)