FBXO22 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO22 Anticorps
- FBXO22 (F-Box Protein 22 (FBXO22))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO22 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO22 antibody was raised against the middle region of FBXO22
- Purification
- Affinity purified
- Immunogène
- FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE
- Top Product
- Discover our top product FBXO22 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO22 Blocking Peptide, catalog no. 33R-1651, is also available for use as a blocking control in assays to test for specificity of this FBXO22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO22 (F-Box Protein 22 (FBXO22))
- Autre désignation
- FBXO22 (FBXO22 Produits)
- Synonymes
- anticorps FBXO22, anticorps DKFZp469L0535, anticorps fbxo22, anticorps MGC146708, anticorps si:busm1-132m23.3, anticorps FBX22, anticorps FISTC1, anticorps 0610033L19Rik, anticorps 1600016C16Rik, anticorps F-box protein 22, anticorps FBXO22, anticorps fbxo22, anticorps Fbxo22
- Sujet
- FBXO22 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO22 belongs to the Fbxs class. Two transcript variants encoding different isoforms exist for this gene.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-