FBXL16 anticorps (Middle Region)

N° du produit ABIN632354

Détail du produit anti-FBXL16 anticorps

Antigène: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL16 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXL16 antibody was raised against the middle region of FBXL16

Purification: Affinity purified

Immunogène: FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL16

Antigène: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Autre désignation: FBXL16 (FBXL16 Produits)

Synonymes: anticorps C16orf22, anticorps Fbl16, anticorps c380A1.1, anticorps BC042620, anticorps Scirr1, anticorps VIER F-box proteine 2, anticorps F-box and leucine rich repeat protein 16, anticorps fbxl16, putative, anticorps F-box and leucine-rich repeat protein 16, anticorps VIER F-box protein 2, anticorps FBXL16, anticorps Smp_174380, anticorps fbxl16, anticorps Fbxl16, anticorps VFB2

Sujet: FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Poids moléculaire: 52 kDa (MW of target protein)