UFL1 anticorps (Middle Region)
-
- Antigène Voir toutes UFL1 Anticorps
- UFL1 (UFM1-Specific Ligase 1 (UFL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UFL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA0776 antibody was raised against the middle region of KIAA0776
- Purification
- Affinity purified
- Immunogène
- KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR
- Top Product
- Discover our top product UFL1 Anticorps primaire
-
anti-UFM1-Specific Ligase 1 (UFL1) antibody
UFL1 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) (AA 426-455) antibodyUFL1 Reactivité: Humain WB Hôte: Lapin Polyclonal RB24469 unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) antibodyUFL1 Reactivité: Humain IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) (AA 503-552) antibodyUFL1 Reactivité: Humain, Souris, Cheval, Boeuf (Vache), Chien, Cobaye, Lapin, Rat, Porc, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA0776 Blocking Peptide, catalog no. 33R-2824, is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0776 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UFL1 (UFM1-Specific Ligase 1 (UFL1))
- Autre désignation
- KIAA0776 (UFL1 Produits)
- Synonymes
- anticorps 1810074P20Rik, anticorps AI429228, anticorps Kiaa0776, anticorps Maxer, anticorps Rcad, anticorps mKIAA0776, anticorps KIAA0776, anticorps NLBP, anticorps RCAD, anticorps RP3-393D12.1, anticorps RGD1309308, anticorps zgc:63562, anticorps UFM1 specific ligase 1, anticorps Ufm1-specific ligase 1, anticorps UFM1-specific ligase 1, anticorps Ufl1, anticorps UFL1, anticorps ufl1
- Sujet
- KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.
- Poids moléculaire
- 89 kDa (MW of target protein)
-
