AP2B1 anticorps (Middle Region)
-
- Antigène Voir toutes AP2B1 Anticorps
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AP2B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AP2 B1 antibody was raised against the middle region of AP2 1
- Purification
- Affinity purified
- Immunogène
- AP2 B1 antibody was raised using the middle region of AP2 1 corresponding to a region with amino acids DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI
- Top Product
- Discover our top product AP2B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AP2B1 Blocking Peptide, catalog no. 33R-2077, is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
- Autre désignation
- AP2B1 (AP2B1 Produits)
- Synonymes
- anticorps 5-HT(2B), anticorps 5-HT2B, anticorps ADTB2, anticorps AP105B, anticorps AP2-BETA, anticorps CLAPB1, anticorps 1300012O03Rik, anticorps AI788979, anticorps fa16e07, anticorps wu:fa16c06, anticorps wu:fa16e07, anticorps wu:fc18c08, anticorps zgc:55659, anticorps 5-hydroxytryptamine receptor 2B, anticorps adaptor related protein complex 2 beta 1 subunit, anticorps adaptor-related protein complex 2, beta 1 subunit, anticorps adaptor related protein complex 2 beta 1 subunit L homeolog, anticorps HTR2B, anticorps AP2B1, anticorps Ap2b1, anticorps ap2b1, anticorps ap2b1.L
- Sujet
- AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.
- Poids moléculaire
- 105 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation
-