LIN37 anticorps

N° du produit ABIN632413

Détail du produit anti-LIN37 anticorps

Antigène: LIN37 (Lin-37 Homolog (LIN37))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIN37 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIN37 Blocking Peptide, catalog no. 33R-3828, is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIN37

Antigène: LIN37 (Lin-37 Homolog (LIN37))

Autre désignation: LIN37 (LIN37 Produits)

Synonymes: anticorps F25965, anticorps ZK418.4, anticorps lin-37, anticorps 1810054G18Rik, anticorps lin-37 DREAM MuvB core complex component, anticorps lin-37 homolog (C. elegans), anticorps LIN37, anticorps Lin37

Sujet: This gene encodes a protein expressed in the eye.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Mitotic G1-G1/S Phases