EXOC6 anticorps (Middle Region)
-
- Antigène Voir toutes EXOC6 Anticorps
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXOC6 antibody was raised against the middle region of EXOC6
- Purification
- Affinity purified
- Immunogène
- EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
- Top Product
- Discover our top product EXOC6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOC6 Blocking Peptide, catalog no. 33R-10220, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
- Autre désignation
- EXOC6 (EXOC6 Produits)
- Synonymes
- anticorps Sec15, anticorps Sec15l1, anticorps EXOC6A, anticorps SEC15, anticorps SEC15L, anticorps SEC15L1, anticorps SEC15L3, anticorps Sec15p, anticorps 4833405E05Rik, anticorps AW413330, anticorps C430002C19, anticorps hbd, anticorps msec15, anticorps zgc:77548, anticorps SEC15A, anticorps EXOC6, anticorps 3R41, anticorps CG7034, anticorps Dmel\\CG7034, anticorps dsec15, anticorps exocyst complex component 6, anticorps exocyst complex component 6B, anticorps Exocyst complex component 6, anticorps Secretory 15, anticorps Exoc6, anticorps EXOC6, anticorps exoc6, anticorps LOC410084, anticorps EXOC6B, anticorps CpipJ_CPIJ005438, anticorps Tsp_03288, anticorps sec-15, anticorps Sec15
- Sujet
- The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 94 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-