CCT5 anticorps

N° du produit ABIN632461

Cet anticorps Lapin Polyclonal détecte spécifiquement CCT5 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CCT5 anticorps (ABIN632461)

Antigène: CCT5 (Chaperonin Containing TCP1, Subunit 5 (Epsilon) (CCT5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCT5 anticorps

Purification: Affinity purified

Immunogène: CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCT5 Blocking Peptide, (ABIN937258), is also available for use as a blocking control in assays to test for specificity of this CCT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCT5

Antigène: CCT5 (Chaperonin Containing TCP1, Subunit 5 (Epsilon) (CCT5))

Autre désignation: CCT5

Sujet: CCT5 is a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Poids moléculaire: 60 kDa (MW of target protein)