Actin-Like 6B anticorps (Middle Region)
-
- Antigène Voir toutes Actin-Like 6B (ACTL6B) Anticorps
- Actin-Like 6B (ACTL6B)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Actin-Like 6B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACTL6 B antibody was raised against the middle region of ACTL6
- Purification
- Affinity purified
- Immunogène
- ACTL6 B antibody was raised using the middle region of ACTL6 corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS
- Top Product
- Discover our top product ACTL6B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTL6B Blocking Peptide, catalog no. 33R-3319, is also available for use as a blocking control in assays to test for specificity of this ACTL6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Actin-Like 6B (ACTL6B)
- Autre désignation
- ACTL6B (ACTL6B Produits)
- Synonymes
- anticorps MGC110167, anticorps zgc:110167, anticorps ACTL6, anticorps BAF53B, anticorps Actl6, anticorps ArpNa, anticorps Baf53b, anticorps actin-like 6B, anticorps actin like 6B, anticorps actl6b, anticorps ACTL6B, anticorps Actl6b
- Sujet
- The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins.
- Poids moléculaire
- 47 kDa (MW of target protein)
-