TRAPPC1 anticorps (Middle Region)

N° du produit ABIN632552

Détail du produit anti-TRAPPC1 anticorps

Antigène: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAPPC1 antibody was raised against the middle region of TRAPPC1

Purification: Affinity purified

Immunogène: TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC1

Antigène: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Autre désignation: TRAPPC1 (TRAPPC1 Produits)

Synonymes: anticorps BET5, anticorps MUM2, anticorps D11Ertd172e, anticorps zgc:100969, anticorps MGC83988, anticorps bet5, anticorps mum2, anticorps trafficking protein particle complex 1, anticorps trafficking protein particle complex 1 L homeolog, anticorps TRAPPC1, anticorps Trappc1, anticorps trappc1, anticorps trappc1.L

Sujet: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 17 kDa (MW of target protein)