MTMR14 anticorps (Middle Region)

N° du produit ABIN632568

Détail du produit anti-MTMR14 anticorps

Antigène: MTMR14 (Myotubularin Related Protein 14 (MTMR14))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTMR14 est non-conjugé

Application: Western Blotting (WB)

Specificité: MTMR14 antibody was raised against the middle region of MTMR14

Purification: Affinity purified

Immunogène: MTMR14 antibody was raised using the middle region of MTMR14 corresponding to a region with amino acids NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTMR14 Blocking Peptide, catalog no. 33R-6688, is also available for use as a blocking control in assays to test for specificity of this MTMR14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTMR14

Antigène: MTMR14 (Myotubularin Related Protein 14 (MTMR14))

Autre désignation: MTMR14 (MTMR14 Produits)

Synonymes: anticorps fc14d11, anticorps wu:fc14d11, anticorps MGC131146, anticorps C3orf29, anticorps 1110061O04Rik, anticorps AW553738, anticorps C76151, anticorps RGD1304842, anticorps jumpy, anticorps myotubularin related protein 14, anticorps myotubularin-related protein 14, anticorps myotubularin related protein 14 S homeolog, anticorps mtmr14, anticorps LOC703936, anticorps mtmr14.S, anticorps MTMR14, anticorps Mtmr14

Sujet: This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Inositol Metabolic Process