GLUD2 anticorps (N-Term)

N° du produit ABIN632576

Détail du produit anti-GLUD2 anticorps

Antigène: GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLUD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLUD2 antibody was raised against the N terminal of GLUD2

Purification: Affinity purified

Immunogène: GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLUD2 Blocking Peptide, catalog no. 33R-2428, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLUD2

Antigène: GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))

Autre désignation: GLUD2 (GLUD2 Produits)

Synonymes: anticorps GDH2, anticorps GLUDP1, anticorps GLUTAMATE DEHYDROGENASE 2, anticorps T2I1.150, anticorps T2I1_150, anticorps glutamate dehydrogenase 2, anticorps glutamate dehydrogenase 2, anticorps glutamate dehydrogenase, anticorps GLUD2, anticorps GDH2, anticorps NP_RS03950

Sujet: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Synaptic Membrane