Nodal anticorps
-
- Antigène Voir toutes Nodal (NODAL) Anticorps
- Nodal (NODAL) (Nodal Homolog (NODAL))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Nodal est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH
- Top Product
- Discover our top product NODAL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NODAL Blocking Peptide, catalog no. 33R-2404, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NODAL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Nodal (NODAL) (Nodal Homolog (NODAL))
- Autre désignation
- NODAL (NODAL Produits)
- Synonymes
- anticorps NODAL, anticorps Tg.413d, anticorps HTX5, anticorps nodal4, anticorps nodal4-A, anticorps nr4, anticorps xnr4, anticorps Xnr-1, anticorps nodal, anticorps nr1, anticorps nr1-A, anticorps nodal growth differentiation factor, anticorps nodal homolog (mouse), anticorps nodal, anticorps nodal growth differentiation factor L homeolog, anticorps nodal homolog 1 L homeolog, anticorps Nodal, anticorps NODAL, anticorps nodal.L, anticorps nodal1.L
- Sujet
- The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of Endopeptidase Activity
-