Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) anticorps

N° du produit ABIN632668

Détail du produit

Antigène: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: APBB1 IP antibody was raised against the N terminal Of Apbb1 p

Purification: Affinity purified

Immunogène: APBB1 IP antibody was raised using the N terminal Of Apbb1 p corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APBB1IP Blocking Peptide, catalog no. 33R-5496, is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Autre désignation: APBB1IP (APBB1IP Produits)

Synonymes: anticorps zgc:63968, anticorps apbb1ip, anticorps MGC80693, anticorps APBB1IP, anticorps INAG1, anticorps PREL1, anticorps RARP1, anticorps RIAM, anticorps 9930118P07Rik, anticorps Prp48, anticorps amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein, anticorps amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein S homeolog, anticorps amyloid beta precursor protein binding family B member 1 interacting protein, anticorps amyloid beta A4 precursor protein-binding family B member 1-interacting protein, anticorps apbb1ip, anticorps apbb1ip.S, anticorps APBB1IP, anticorps LOC707383, anticorps LOC100439620, anticorps LOC100598478, anticorps Apbb1ip

Sujet: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Poids moléculaire: 73 kDa (MW of target protein)