GPRASP2 anticorps (Middle Region)
-
- Antigène Voir toutes GPRASP2 Anticorps
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPRASP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPRASP2 antibody was raised against the middle region of GPRASP2
- Purification
- Affinity purified
- Immunogène
- GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
- Top Product
- Discover our top product GPRASP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPRASP2 Blocking Peptide, catalog no. 33R-2662, is also available for use as a blocking control in assays to test for specificity of this GPRASP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPRASP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
- Autre désignation
- GPRASP2 (GPRASP2 Produits)
- Synonymes
- anticorps GASP2, anticorps 5330440H13Rik, anticorps Prpl5, anticorps RGD1561019, anticorps G protein-coupled receptor associated sorting protein 2, anticorps GPRASP2, anticorps Gprasp2
- Sujet
- The function of FAM14A protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 94 kDa (MW of target protein)
-