BEND2 anticorps (Middle Region)

N° du produit ABIN632759

Détail du produit anti-BEND2 anticorps

Antigène: BEND2 (BEN Domain Containing 2 (BEND2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BEND2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CXORF20 antibody was raised against the middle region of Cxorf20

Purification: Affinity purified

Immunogène: CXORF20 antibody was raised using the middle region of Cxorf20 corresponding to a region with amino acids DGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXORF20 Blocking Peptide, catalog no. 33R-1949, is also available for use as a blocking control in assays to test for specificity of this CXORF20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BEND2

Antigène: BEND2 (BEN Domain Containing 2 (BEND2))

Autre désignation: CXORF20 (BEND2 Produits)

Synonymes: anticorps CXorf20, anticorps BEN domain containing 2, anticorps BEND2

Sujet: The function of CXorf20 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 88 kDa (MW of target protein)