PDZD9 anticorps (Middle Region)

N° du produit ABIN632838

Détail du produit anti-PDZD9 anticorps

Antigène: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDZD9 est non-conjugé

Application: Western Blotting (WB)

Specificité: C16 ORF65 antibody was raised against the middle region of C16 rf65

Purification: Affinity purified

Immunogène: C16 ORF65 antibody was raised using the middle region of C16 rf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C16ORF65 Blocking Peptide, catalog no. 33R-9303, is also available for use as a blocking control in assays to test for specificity of this C16ORF65 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDZD9

Antigène: PDZD9 (PDZ Domain Containing 9 (PDZD9))

Autre désignation: C16ORF65 (PDZD9 Produits)

Synonymes: anticorps C16orf65, anticorps C25H16orf65, anticorps 4930408O21Rik, anticorps LRRGT00105, anticorps PDZ domain containing 9, anticorps PDZD9, anticorps Pdzd9

Sujet: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 23 kDa (MW of target protein)