PREP anticorps (Middle Region)
-
- Antigène Voir toutes PREP Anticorps
- PREP (Prolyl Endopeptidase (PREP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PREP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PREP antibody was raised against the middle region of PREP
- Purification
- Affinity purified
- Immunogène
- PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM
- Top Product
- Discover our top product PREP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PREP Blocking Peptide, catalog no. 33R-5028, is also available for use as a blocking control in assays to test for specificity of this PREP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PREP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PREP (Prolyl Endopeptidase (PREP))
- Autre désignation
- PREP (PREP Produits)
- Synonymes
- anticorps PE, anticorps PEP, anticorps AI047692, anticorps AI450383, anticorps D10Wsu136e, anticorps Pop, anticorps rPop, anticorps im:7140031, anticorps zgc:110670, anticorps prolyl endopeptidase, anticorps Prolyl endopeptidase, anticorps RB12337, anticorps AM1_4884, anticorps ppce, anticorps PREP, anticorps Prep, anticorps prep
- Sujet
- PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.
- Poids moléculaire
- 81 kDa (MW of target protein)
-