PSMA5 anticorps
-
- Antigène Voir toutes PSMA5 Anticorps
- PSMA5 (Proteasome Subunit alpha 5 (PSMA5))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK
- Top Product
- Discover our top product PSMA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMA5 Blocking Peptide, catalog no. 33R-2904, is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMA5 (Proteasome Subunit alpha 5 (PSMA5))
- Autre désignation
- PSMA5 (PSMA5 Produits)
- Synonymes
- anticorps 154644_at, anticorps Alpha-5, anticorps CG10938, anticorps Dmel\\CG10938, anticorps PRCZ, anticorps PSA5_DROME, anticorps PSMA5, anticorps ProsMA5, anticorps alpha5, anticorps alpha5_dm, anticorps prosMA5, anticorps DDBDRAFT_0216562, anticorps DDBDRAFT_0232930, anticorps DDB_0216562, anticorps DDB_0232930, anticorps ZETA, anticorps PSC5, anticorps zgc:86851, anticorps Proteasome alpha5 subunit, anticorps proteasome subunit alpha type 5, putative, anticorps proteasome subunit alpha type 5, anticorps 20S proteasome subunit alpha-5, anticorps proteasome (prosome, macropain) subunit, alpha type 5, anticorps proteasome subunit alpha 5, anticorps proteasome subunit alpha 5 S homeolog, anticorps proteasome (prosome, macropain) subunit, alpha type, 5, anticorps Prosalpha5, anticorps PF07_0112, anticorps CNH01360, anticorps cgd5_1820, anticorps PSA5, anticorps psmA5, anticorps NAEGRDRAFT_55551, anticorps LOC100282220, anticorps LOC100283546, anticorps Psma5, anticorps PSMA5, anticorps psma5.S, anticorps psma5
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-