PSMC4 anticorps
-
- Antigène Voir toutes PSMC4 Anticorps
- PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
- Top Product
- Discover our top product PSMC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMC4 Blocking Peptide, catalog no. 33R-5903, is also available for use as a blocking control in assays to test for specificity of this PSMC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))
- Autre désignation
- PSMC4 (PSMC4 Produits)
- Synonymes
- anticorps NCU02260.1, anticorps AO090003000692, anticorps DDBDRAFT_0188209, anticorps DDBDRAFT_0191435, anticorps DDB_0188209, anticorps DDB_0191435, anticorps MIP224, anticorps RPT3, anticorps S6, anticorps TBP-7, anticorps TBP7, anticorps CIP21, anticorps Tbp7, anticorps 26S protease regulatory subunit 6B, anticorps regulatory particle, ATPase-like-3, anticorps 26S proteasome regulatory subunit 6B, anticorps proteasome 26S subunit, ATPase 4, anticorps proteasome (prosome, macropain) 26S subunit, ATPase, 4, anticorps LOC732870, anticorps rpt-3, anticorps ATEG_04674, anticorps LELG_01296, anticorps HCAG_00039, anticorps LOC5568998, anticorps GL50803_7950, anticorps EDI_044950, anticorps AOR_1_1218154, anticorps PTRG_03339, anticorps psmC4, anticorps prs6b, anticorps LOC100381342, anticorps psmc4, anticorps PSMC4, anticorps Psmc4
- Sujet
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway
-