RPE anticorps (Middle Region)
-
- Antigène Voir toutes RPE Anticorps
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPE est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPE antibody was raised against the middle region of RPE
- Purification
- Affinity purified
- Immunogène
- RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
- Top Product
- Discover our top product RPE Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPE Blocking Peptide, catalog no. 33R-6239, is also available for use as a blocking control in assays to test for specificity of this RPE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
- Autre désignation
- RPE (RPE Produits)
- Synonymes
- anticorps wu:fa07h08, anticorps wu:fb93d11, anticorps wu:fc20b11, anticorps ik:tdsubc_2c8, anticorps xx:tdsubc_2c8, anticorps RPE2-1, anticorps 2810429B02Rik, anticorps 5730518J08Rik, anticorps ribulose-5-phosphate-3-epimerase, anticorps rpe, anticorps RPE, anticorps Rpe
- Sujet
- The function of RPE protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 25 kDa (MW of target protein)
-