CUTC anticorps
-
- Antigène Voir toutes CUTC Anticorps
- CUTC (CutC Copper Transporter Homolog (CUTC))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CUTC est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST
- Top Product
- Discover our top product CUTC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CUTC Blocking Peptide, catalog no. 33R-4899, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CUTC (CutC Copper Transporter Homolog (CUTC))
- Autre désignation
- CUTC (CUTC Produits)
- Synonymes
- anticorps zgc:103406, anticorps RP11-483F11.3, anticorps 2310039I18Rik, anticorps AI326282, anticorps CGI-32, anticorps cutC copper transporter, anticorps cutC copper transporter homolog (E. coli), anticorps CUTC, anticorps cutc, anticorps Cutc
- Sujet
- Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-