CUTC anticorps

N° du produit ABIN632915

Détail du produit anti-CUTC anticorps

Antigène: CUTC (CutC Copper Transporter Homolog (CUTC))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CUTC est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUTC Blocking Peptide, catalog no. 33R-4899, is also available for use as a blocking control in assays to test for specificity of this CUTC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CUTC

Antigène: CUTC (CutC Copper Transporter Homolog (CUTC))

Autre désignation: CUTC (CUTC Produits)

Synonymes: anticorps zgc:103406, anticorps RP11-483F11.3, anticorps 2310039I18Rik, anticorps AI326282, anticorps CGI-32, anticorps cutC copper transporter, anticorps cutC copper transporter homolog (E. coli), anticorps CUTC, anticorps cutc, anticorps Cutc

Sujet: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis