SDR9C7 anticorps (Middle Region)

N° du produit ABIN632990

Détail du produit anti-SDR9C7 anticorps

Antigène: SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDR9C7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SDR-O antibody was raised against the middle region of SDR-O

Purification: Affinity purified

Immunogène: SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDR-O Blocking Peptide, catalog no. 33R-10433, is also available for use as a blocking control in assays to test for specificity of this SDR-O antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDR-O antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDR9C7

Antigène: SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))

Autre désignation: SDR-O (SDR9C7 Produits)

Synonymes: anticorps RDHS, anticorps SDR-O, anticorps SDRO, anticorps 1810054F20Rik, anticorps Rdh20, anticorps Rdhs, anticorps Sdro, anticorps Sdr-o, anticorps short chain dehydrogenase/reductase family 9C member 7, anticorps 4short chain dehydrogenase/reductase family 9C, member 7, anticorps short chain dehydrogenase/reductase family 9C, member 7, anticorps SDR9C7, anticorps Sdr9c7

Sujet: SDR-O displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity.

Poids moléculaire: 35 kDa (MW of target protein)