NXPH3 anticorps (N-Term)
-
- Antigène Voir toutes NXPH3 Anticorps
- NXPH3 (Neurexophilin 3 (NXPH3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NXPH3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Neurexophilin 3 antibody was raised against the N terminal of NXPH3
- Purification
- Affinity purified
- Immunogène
- Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN
- Top Product
- Discover our top product NXPH3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Neurexophilin 3 Blocking Peptide, catalog no. 33R-7840, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NXPH3 (Neurexophilin 3 (NXPH3))
- Autre désignation
- Neurexophilin 3 (NXPH3 Produits)
- Synonymes
- anticorps NPH3, anticorps Nph3, anticorps neurexophilin 3, anticorps neurexophilin 3 S homeolog, anticorps NXPH3, anticorps nxph3.S, anticorps nxph3, anticorps Nxph3
- Sujet
- NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
- Poids moléculaire
- 28 kDa (MW of target protein)
-