HSD3B7 anticorps (Middle Region)
-
- Antigène Voir toutes HSD3B7 Anticorps
- HSD3B7 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 7 (HSD3B7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HSD3B7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HSD3 B7 antibody was raised against the middle region of HSD3 7
- Purification
- Affinity purified
- Immunogène
- HSD3 B7 antibody was raised using the middle region of HSD3 7 corresponding to a region with amino acids QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
- Top Product
- Discover our top product HSD3B7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HSD3B7 Blocking Peptide, catalog no. 33R-7574, is also available for use as a blocking control in assays to test for specificity of this HSD3B7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HSD3B7 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 7 (HSD3B7))
- Autre désignation
- HSD3B7 (HSD3B7 Produits)
- Synonymes
- anticorps CBAS1, anticorps PFIC4, anticorps SDR11E3, anticorps AI195443, anticorps BB098564, anticorps Cca2, anticorps hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7, anticorps HSD3B7, anticorps Hsd3b7
- Sujet
- This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 41 kDa (MW of target protein)
-