MITD1 anticorps (Middle Region)

N° du produit ABIN633079

Détail du produit anti-MITD1 anticorps

Antigène: MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MITD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MITD1 antibody was raised against the middle region of MITD1

Purification: Affinity purified

Immunogène: MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MITD1 Blocking Peptide, catalog no. 33R-7804, is also available for use as a blocking control in assays to test for specificity of this MITD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MITD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MITD1

Antigène: MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))

Autre désignation: MITD1 (MITD1 Produits)

Synonymes: anticorps zgc:56159, anticorps MGC88990, anticorps MGC128843, anticorps MGC115722, anticorps 1500032H18Rik, anticorps RGD1307700, anticorps MIT, microtubule interacting and transport, domain containing 1, anticorps microtubule interacting and trafficking domain containing 1, anticorps microtubule interacting and trafficking domain containing 1 L homeolog, anticorps mitd1, anticorps MITD1, anticorps mitd1.L, anticorps Mitd1

Sujet: MITD1 may play a role in endosomal protein transport.

Poids moléculaire: 29 kDa (MW of target protein)