CSH1 anticorps (Middle Region)

N° du produit ABIN633099

Détail du produit anti-CSH1 anticorps

Antigène: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSH1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CSH2 antibody was raised against the middle region of CSH2

Purification: Affinity purified

Immunogène: CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSH2 Blocking Peptide, catalog no. 33R-4935, is also available for use as a blocking control in assays to test for specificity of this CSH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSH1

Antigène: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Autre désignation: CSH2 (CSH1 Produits)

Synonymes: anticorps CS-1, anticorps CSA, anticorps CSMT, anticorps PL, anticorps hCS-A, anticorps CS-2, anticorps CSB, anticorps hCS-B, anticorps chorionic somatomammotropin hormone 1, anticorps chorionic somatomammotropin hormone 2, anticorps CSH1, anticorps CSH2

Sujet: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus