PRSS3 anticorps (N-Term)

N° du produit ABIN633109

Détail du produit anti-PRSS3 anticorps

Antigène: PRSS3 (Protease, serine, 3 (PRSS3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRSS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRSS3 antibody was raised against the N terminal of PRSS3

Purification: Affinity purified

Immunogène: PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRSS3 Blocking Peptide, catalog no. 33R-9443, is also available for use as a blocking control in assays to test for specificity of this PRSS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRSS3

Antigène: PRSS3 (Protease, serine, 3 (PRSS3))

Autre désignation: PRSS3 (PRSS3 Produits)

Synonymes: anticorps MTG, anticorps PRSS4, anticorps T9, anticorps TRY3, anticorps TRY4, anticorps Try3, anticorps Tb, anticorps prss3, anticorps protease, serine 3, anticorps trypsin-3, anticorps protease, serine, 3, anticorps trypsin III, anticorps protease, serine 3 L homeolog, anticorps PRSS3, anticorps CpipJ_CPIJ016105, anticorps Prss3, anticorps trp-iii, anticorps prss3.L

Sujet: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Poids moléculaire: 33 kDa (MW of target protein)