GLCCI1 anticorps (Middle Region)
-
- Antigène Voir toutes GLCCI1 Anticorps
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLCCI1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLCCI1 antibody was raised against the middle region of GLCCI1
- Purification
- Affinity purified
- Immunogène
- GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD
- Top Product
- Discover our top product GLCCI1 Anticorps primaire
-
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 226-255) antibody
GLCCI1 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB32643 unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 104-133), (N-Term) antibodyGLCCI1 Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB28551 unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) antibodyGLCCI1 Reactivité: Humain, Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) antibodyGLCCI1 Reactivité: Humain IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 120-230) antibodyGLCCI1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 179-228) antibodyGLCCI1 Reactivité: Humain, Souris, Boeuf (Vache), Cheval, Porc, Rat, Chien, Poulet, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 255-304) antibodyGLCCI1 Reactivité: Humain, Souris, Boeuf (Vache), Cheval, Porc, Rat, Lapin, Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (Middle Region) antibodyGLCCI1 Reactivité: Humain, Souris, Boeuf (Vache), Cheval, Porc, Rat, Lapin, Chien, Cobaye WB Hôte: Lapin Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 233-263), (Middle Region) antibodyGLCCI1 Reactivité: Humain WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLCCI1 Blocking Peptide, catalog no. 33R-7448, is also available for use as a blocking control in assays to test for specificity of this GLCCI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLCCI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
- Autre désignation
- GLCCI1 (GLCCI1 Produits)
- Synonymes
- anticorps FAM117C, anticorps GCTR, anticorps GIG18, anticorps TSSN1, anticorps 2310047L21Rik, anticorps A130036A18Rik, anticorps Fam117c, anticorps Gig18, anticorps Tssn1, anticorps sb:cb902, anticorps testhymin, anticorps zgc:158237, anticorps RGD1563612, anticorps glucocorticoid induced 1, anticorps glucocorticoid induced transcript 1, anticorps glucocorticoid induced 1a, anticorps glucocorticoid induced 1 L homeolog, anticorps GLCCI1, anticorps Glcci1, anticorps glcci1a, anticorps glcci1.L
- Sujet
- The function of GLCCI protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 58 kDa (MW of target protein)
-
