HSD17B11 anticorps

N° du produit ABIN633162

Détail du produit anti-HSD17B11 anticorps

Antigène: HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD17B11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HSD17 B11 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSD17B11 Blocking Peptide, catalog no. 33R-9080, is also available for use as a blocking control in assays to test for specificity of this HSD17B11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSD17B11

Antigène: HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))

Autre désignation: HSD17B11 (HSD17B11 Produits)

Synonymes: anticorps 17BHSD11, anticorps DHRS8, anticorps PAN1B, anticorps RETSDR2, anticorps SDR16C2, anticorps Dhrs8, anticorps HSD17B13, anticorps MGC84756, anticorps HSD17B11, anticorps Pan1b, anticorps SDR2, anticorps retSDR2, anticorps 17-beta-HSD 11, anticorps 17-beta-HSD XI, anticorps 17bHSD11, anticorps 17betaHSD11, anticorps 17betaHSDXI, anticorps hydroxysteroid 17-beta dehydrogenase 11, anticorps hydroxysteroid (17-beta) dehydrogenase 11, anticorps hydroxysteroid (17-beta) dehydrogenase 11 L homeolog, anticorps estradiol 17-beta-dehydrogenase 11, anticorps HSD17B11, anticorps Hsd17b11, anticorps hsd17b11.L, anticorps hsd17b11, anticorps LOC100348005, anticorps LOC100520923

Sujet: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones.

Poids moléculaire: 33 kDa (MW of target protein)