PTBP1 anticorps (N-Term)

N° du produit ABIN633199

Détail du produit anti-PTBP1 anticorps

Antigène: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PTBP1 antibody was raised against the N terminal of PTBP1

Purification: Affinity purified

Immunogène: PTBP1 antibody was raised using the N terminal of PTBP1 corresponding to a region with amino acids RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTBP1 Blocking Peptide, catalog no. 33R-7938, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTBP1

Antigène: PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))

Autre désignation: PTBP1 (PTBP1 Produits)

Synonymes: anticorps HNRNP-I, anticorps HNRNPI, anticorps HNRPI, anticorps PTB, anticorps PTB-1, anticorps PTB-T, anticorps PTB2, anticorps PTB3, anticorps PTB4, anticorps pPTB, anticorps Ptb, anticorps hnrpi, anticorps hnrnp-I, anticorps vgrbp60, anticorps AA407203, anticorps AL033359, anticorps Pybp, anticorps Pybp1, anticorps Pybp2, anticorps ptbp1, anticorps wu:fb99f12, anticorps zgc:110689, anticorps ptb, anticorps ATPTB1, anticorps POLYPYRIMIDINE TRACT-BINDING, anticorps POLYPYRIMIDINE TRACT-BINDING PROTEIN 1, anticorps T4P13.16, anticorps T4P13_16, anticorps polypyrimidine tract-binding protein 1, anticorps PTBP1, anticorps polypyrimidine tract binding protein 1, anticorps polypyrimidine tract binding protein 1 S homeolog, anticorps polypyrimidine tract-binding protein, anticorps polypyrimidine tract binding protein 1a, anticorps polypyrimidine tract binding protein 1 L homeolog, anticorps polypyrimidine tract-binding protein 1, anticorps PTBP1, anticorps ptbp1.S, anticorps NAEGRDRAFT_80143, anticorps LOC100285404, anticorps Ptbp1, anticorps ptbp1a, anticorps ptbp1.L, anticorps PTB1, anticorps LOC100061673

Sujet: PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation