PTBP1 anticorps (Middle Region)
-
- Antigène Voir toutes PTBP1 Anticorps
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PTBP1 antibody was raised against the middle region of PTBP1
- Purification
- Affinity purified
- Immunogène
- PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI
- Top Product
- Discover our top product PTBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTBP1 Blocking Peptide, catalog no. 33R-4388, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTBP1 (Polypyrimidine Tract Binding Protein 1 (PTBP1))
- Autre désignation
- PTBP1 (PTBP1 Produits)
- Synonymes
- anticorps HNRNP-I, anticorps HNRNPI, anticorps HNRPI, anticorps PTB, anticorps PTB-1, anticorps PTB-T, anticorps PTB2, anticorps PTB3, anticorps PTB4, anticorps pPTB, anticorps Ptb, anticorps hnrpi, anticorps hnrnp-I, anticorps vgrbp60, anticorps AA407203, anticorps AL033359, anticorps Pybp, anticorps Pybp1, anticorps Pybp2, anticorps ptbp1, anticorps wu:fb99f12, anticorps zgc:110689, anticorps ptb, anticorps ATPTB1, anticorps POLYPYRIMIDINE TRACT-BINDING, anticorps POLYPYRIMIDINE TRACT-BINDING PROTEIN 1, anticorps T4P13.16, anticorps T4P13_16, anticorps polypyrimidine tract-binding protein 1, anticorps PTBP1, anticorps polypyrimidine tract binding protein 1, anticorps polypyrimidine tract binding protein 1 S homeolog, anticorps polypyrimidine tract-binding protein, anticorps polypyrimidine tract binding protein 1a, anticorps polypyrimidine tract binding protein 1 L homeolog, anticorps polypyrimidine tract-binding protein 1, anticorps PTBP1, anticorps ptbp1.S, anticorps NAEGRDRAFT_80143, anticorps LOC100285404, anticorps Ptbp1, anticorps ptbp1a, anticorps ptbp1.L, anticorps PTB1, anticorps LOC100061673
- Sujet
- PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.
- Poids moléculaire
- 60 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation
-