XPO1 anticorps

N° du produit ABIN633201

Détail du produit anti-XPO1 anticorps

Antigène: XPO1 (Exportin 1 (XPO1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPO1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XPO1 Blocking Peptide, catalog no. 33R-4086, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XPO1

Antigène: XPO1 (Exportin 1 (XPO1))

Autre désignation: XPO1 (XPO1 Produits)

Synonymes: anticorps CG13387, anticorps CRM1, anticorps Crm1, anticorps DCRM1, anticorps Dmel\\CG13387, anticorps Emb, anticorps XPO-1, anticorps XPO1, anticorps Xpo1, anticorps crm1, anticorps dCRM1, anticorps l(2)k16715, anticorps 18.m06600, anticorps DDBDRAFT_0183812, anticorps DDBDRAFT_0234066, anticorps DDB_0183812, anticorps DDB_0234066, anticorps exportin-1, anticorps LOC100220104, anticorps emb, anticorps exp1, anticorps Xpo, anticorps AA420417, anticorps Exp1, anticorps embargoed, anticorps exportin 1, anticorps putative exportin 1, anticorps chromosome region maintenance protein 1, anticorps exportin-1, anticorps exportin 1 (CRM1 homolog, yeast), anticorps exportin 1 S homeolog, anticorps emb, anticorps cgd3_3060, anticorps Tc00.1047053511725.150, anticorps Tb11.01.5940, anticorps BBOV_II007220, anticorps LMJF_32_1100, anticorps xpo1, anticorps Xpo1, anticorps XPO1, anticorps LOC100165622, anticorps LOC100633509, anticorps xpo1.S

Sujet: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is also involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.

Poids moléculaire: 123 kDa (MW of target protein)

Pathways: M Phase