AARS anticorps (C-Term)

N° du produit ABIN633213

Détail du produit anti-AARS anticorps

Antigène: AARS (Alanyl tRNA Synthetase (AARS))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AARS est non-conjugé

Application: Western Blotting (WB)

Specificité: AARS antibody was raised against the C terminal of AARS

Purification: Affinity purified

Immunogène: AARS antibody was raised using the C terminal of AARS corresponding to a region with amino acids VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AARS Blocking Peptide, catalog no. 33R-9844, is also available for use as a blocking control in assays to test for specificity of this AARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AARS

Antigène: AARS (Alanyl tRNA Synthetase (AARS))

Autre désignation: AARS (AARS Produits)

Synonymes: anticorps im:7146712, anticorps si:ch211-223o1.6, anticorps wu:fc48h07, anticorps zgc:113920, anticorps CMT2N, anticorps AI316495, anticorps C76919, anticorps sti, anticorps alanyl-tRNA synthetase, anticorps alanyl-tRNA synthetase L homeolog, anticorps aars, anticorps aars.L, anticorps AARS, anticorps Aars, anticorps LOC693023

Sujet: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

Poids moléculaire: 107 kDa (MW of target protein)