HNRNPA2B1 anticorps (N-Term)
-
- Antigène Voir toutes HNRNPA2B1 Anticorps
- HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPA2B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1
- Purification
- Affinity purified
- Immunogène
- HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
- Top Product
- Discover our top product HNRNPA2B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))
- Autre désignation
- HNRNPA2B1 (HNRNPA2B1 Produits)
- Synonymes
- anticorps HNRNPA2, anticorps HNRNPB1, anticorps HNRPA2, anticorps HNRPA2B1, anticorps HNRPB1, anticorps RNPA2, anticorps SNRPB1, anticorps hnrpa2b1, anticorps MGC53135, anticorps HNRNPA2B1, anticorps hnrnpa2, anticorps hnrnpb1, anticorps hnrpa2, anticorps hnrpb1, anticorps rnpa2, anticorps snrpb1, anticorps 9130414A06Rik, anticorps Hnrpa2, anticorps Hnrpa2b1, anticorps hnrnp-A, anticorps hnRNP, anticorps heterogeneous nuclear ribonucleoprotein A2/B1, anticorps heterogeneous nuclear ribonucleoprotein A2/B1 S homeolog, anticorps heterogeneous nuclear ribonucleoproteins A2/B1, anticorps HNRNPA2B1, anticorps hnrnpa2b1.S, anticorps hnrnpa2b1, anticorps Hnrnpa2b1, anticorps LOC100353281
- Sujet
- HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
- Poids moléculaire
- 37 kDa (MW of target protein)
-