SHPRH anticorps (N-Term)
-
- Antigène Voir toutes SHPRH Anticorps
- SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SHPRH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SHPRH antibody was raised against the N terminal of SHPRH
- Purification
- Affinity purified
- Immunogène
- SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL
- Top Product
- Discover our top product SHPRH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SHPRH Blocking Peptide, catalog no. 33R-8531, is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHPRH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))
- Autre désignation
- SHPRH (SHPRH Produits)
- Synonymes
- anticorps bA545I5.2, anticorps 2610103K11Rik, anticorps AA450458, anticorps AU024614, anticorps BC006883, anticorps D230017O13Rik, anticorps E130018M05, anticorps SNF2 histone linker PHD RING helicase, anticorps SHPRH, anticorps Shprh
- Sujet
- SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.
- Poids moléculaire
- 190 kDa (MW of target protein)
-