Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

MTR4 anticorps (Superkiller Viralicidic Activity 2-Like 2) Primary Antibody

SKIV2L2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN633265
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    MTR4 (SKIV2L2)
    Reactivité
    • 37
    • 16
    • 11
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain
    Hôte
    • 37
    Lapin
    Clonalité
    • 37
    Polyclonal
    Conjugué
    • 18
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp MTR4 est non-conjugé
    Application
    • 30
    • 19
    • 9
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogène
    SKIV2 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    SKIV2L2 Blocking Peptide, catalog no. 33R-4397, is also available for use as a blocking control in assays to test for specificity of this SKIV2L2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    MTR4 (SKIV2L2)
    Autre désignation
    SKIV2L2 (SKIV2L2 Antibody Extrait)
    Synonymes
    RGD1305984, zgc:63838, wu:fd11a05, SKIV2L2, skiv2l2, Dob1, KIAA0052, Mtr4, fSAP118, 2610528A15Rik, mKIAA0052, Ski2 like RNA helicase 2, superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae), Skiv2l2, skiv2l2, SKIV2L2, LOC100380870
    Sujet
    SKIV2L2 may be involved in pre-mRNA splicing.
    Poids moléculaire
    118 kDa (MW of target protein)
Vous êtes ici:
help Support technique