DDX24 anticorps
-
- Antigène Voir toutes DDX24 Anticorps
- DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX24 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK
- Top Product
- Discover our top product DDX24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX24 Blocking Peptide, catalog no. 33R-2570, is also available for use as a blocking control in assays to test for specificity of this DDX24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))
- Autre désignation
- DDX24 (DDX24 Produits)
- Synonymes
- anticorps DDX24, anticorps DKFZp459P2030, anticorps 1700055J08Rik, anticorps 2510027P10Rik, anticorps AI649272, anticorps DEAD-box helicase 24, anticorps DEAD-box helicase 24 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 24, anticorps DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, anticorps Ddx24, anticorps ddx24.L, anticorps DDX24, anticorps ddx24, anticorps Chro.80030
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.
- Poids moléculaire
- 96 kDa (MW of target protein)
-