DDX24 anticorps

N° du produit ABIN633266

Détail du produit anti-DDX24 anticorps

Antigène: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX24 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX24 Blocking Peptide, catalog no. 33R-2570, is also available for use as a blocking control in assays to test for specificity of this DDX24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX24

Antigène: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Autre désignation: DDX24 (DDX24 Produits)

Synonymes: anticorps DDX24, anticorps DKFZp459P2030, anticorps 1700055J08Rik, anticorps 2510027P10Rik, anticorps AI649272, anticorps DEAD-box helicase 24, anticorps DEAD-box helicase 24 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 24, anticorps DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, anticorps Ddx24, anticorps ddx24.L, anticorps DDX24, anticorps ddx24, anticorps Chro.80030

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Poids moléculaire: 96 kDa (MW of target protein)