KRR1 anticorps (C-Term)

N° du produit ABIN633275

Détail du produit anti-KRR1 anticorps

Antigène: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KRR1 antibody was raised against the C terminal of KRR1

Purification: Affinity purified

Immunogène: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KRR1 Blocking Peptide, catalog no. 33R-4253, is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRR1

Antigène: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Autre désignation: KRR1 (KRR1 Produits)

Synonymes: anticorps hrb2, anticorps zgc:136398, anticorps HRB2, anticorps RIP-1, anticorps 2610511F02Rik, anticorps AI255219, anticorps AI428520, anticorps D10Ertd773e, anticorps Hrb2, anticorps KRR1, small subunit (SSU) processome component, homolog S homeolog, anticorps KRR1, small subunit (SSU) processome component, homolog (yeast), anticorps KRR1, small subunit processome component homolog, anticorps KRR1 small subunit processome component homolog, anticorps krr1.S, anticorps krr1, anticorps KRR1, anticorps LOC475405, anticorps Krr1

Sujet: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Poids moléculaire: 44 kDa (MW of target protein)