IMP3 anticorps
-
- Antigène Voir toutes IMP3 Anticorps
- IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IMP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
- Top Product
- Discover our top product IMP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IMP3 Blocking Peptide, catalog no. 33R-3318, is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))
- Autre désignation
- IMP3 (IMP3 Produits)
- Synonymes
- anticorps BRMS2, anticorps C15orf12, anticorps MRPS4, anticorps 1190002L16Rik, anticorps AI256594, anticorps RGD1306825, anticorps zgc:56526, anticorps imp3, anticorps IMP3, U3 small nucleolar ribonucleoprotein, anticorps IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), anticorps inositol monophosphatase domain containing 1, anticorps IMP3, U3 small nucleolar ribonucleoprotein L homeolog, anticorps IMP3, anticorps Imp3, anticorps imp3, anticorps IMPAD1, anticorps imp3.L
- Sujet
- This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
- Poids moléculaire
- 22 kDa (MW of target protein)
-