DND1 anticorps
-
- Antigène Voir toutes DND1 Anticorps
- DND1 (Dead End Homolog 1 (DND1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DND1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
- Top Product
- Discover our top product DND1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DND1 Blocking Peptide, catalog no. 33R-3840, is also available for use as a blocking control in assays to test for specificity of this DND1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DND1 (Dead End Homolog 1 (DND1))
- Autre désignation
- DND1 (DND1 Produits)
- Synonymes
- anticorps dnd, anticorps xde, anticorps Xdead, anticorps rbms4, anticorps dead-end, anticorps DND1, anticorps BC034897, anticorps RBMS4, anticorps Ter, anticorps DND microRNA-mediated repression inhibitor 1, anticorps dead end protein homolog 1 pseudogene, anticorps dnd1, anticorps LOC100349427, anticorps DND1, anticorps Dnd1
- Sujet
- DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.
- Poids moléculaire
- 39 kDa (MW of target protein)
-