KARS anticorps (C-Term)

N° du produit ABIN633328

Détail du produit anti-KARS anticorps

Antigène: KARS (Lysyl-tRNA Synthetase (KARS))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KARS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KARS antibody was raised against the C terminal of KARS

Purification: Affinity purified

Immunogène: KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KARS Blocking Peptide, catalog no. 33R-3434, is also available for use as a blocking control in assays to test for specificity of this KARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KARS

Antigène: KARS (Lysyl-tRNA Synthetase (KARS))

Autre désignation: KARS (KARS Produits)

Synonymes: anticorps CG12141, anticorps Dmel\\CG12141, anticorps KRS, anticorps LysRS, anticorps cb530, anticorps wu:fa16h02, anticorps zgc:92483, anticorps kars, anticorps MGC53345, anticorps kars2, anticorps krs, anticorps krs-1, anticorps KARS, anticorps Tb06.28P18.190, anticorps CMTRIB, anticorps DFNB89, anticorps KARS1, anticorps KARS2, anticorps AA589550, anticorps AL024334, anticorps AL033315, anticorps AL033367, anticorps D8Ertd698e, anticorps D8Wsu108e, anticorps mKIAA0070, anticorps Lysyl-tRNA synthetase, anticorps lysyl-tRNA synthetase, anticorps lysyl-tRNA synthetase S homeolog, anticorps lysyl-tRNA synthetase L homeolog, anticorps LysRS, anticorps kars, anticorps kars.S, anticorps kars.L, anticorps Bm1_16500, anticorps lysS, anticorps Taci_1118, anticorps Tpau_1737, anticorps Arch_0261, anticorps Trad_2960, anticorps Spirs_3699, anticorps KARS, anticorps LOC100280510, anticorps Tb927.6.1510, anticorps Kars

Sujet: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

Poids moléculaire: 66 kDa (MW of target protein)