ZRSR2 anticorps
-
- Antigène Voir toutes ZRSR2 Anticorps
- ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZRSR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
- Top Product
- Discover our top product ZRSR2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZRSR2 Blocking Peptide, catalog no. 33R-5084, is also available for use as a blocking control in assays to test for specificity of this ZRSR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZRSR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))
- Autre désignation
- ZRSR2 (ZRSR2 Produits)
- Synonymes
- anticorps ZRSR2, anticorps 35kDa, anticorps 5031411E02Rik, anticorps A230052C13Rik, anticorps C77286, anticorps U2af1-rs2, anticorps URP, anticorps RGD1559763, anticorps U2AF1-RS2, anticorps U2AF1L2, anticorps U2AF1RS2, anticorps fb73a09, anticorps wu:fb73a09, anticorps zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2, anticorps zinc finger (CCCH type), RNA binding motif and serine/arginine rich 2, anticorps zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2, anticorps ZRSR2, anticorps zrsr2, anticorps ZRSR2Y, anticorps Zrsr2
- Sujet
- ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-