DDX47 anticorps
-
- Antigène Voir toutes DDX47 Anticorps
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX47 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ
- Top Product
- Discover our top product DDX47 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX47 Blocking Peptide, catalog no. 33R-1040, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
- Autre désignation
- DDX47 (DDX47 Produits)
- Synonymes
- anticorps ddx47, anticorps DDX47, anticorps E4-DBP, anticorps HQ0256, anticorps MSTP162, anticorps RRP3, anticorps 4930588A18Rik, anticorps C77285, anticorps DEAD-box helicase 47, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, anticorps DEAD-box helicase 47 L homeolog, anticorps DDX47, anticorps ddx47, anticorps Ddx47, anticorps ddx47.L
- Sujet
- DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.
- Poids moléculaire
- 50 kDa (MW of target protein)
-