KHSRP anticorps (Middle Region)

N° du produit ABIN633384

Détail du produit anti-KHSRP anticorps

Antigène: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KHSRP est non-conjugé

Application: Western Blotting (WB)

Specificité: KHSRP antibody was raised against the middle region of KHSRP

Purification: Affinity purified

Immunogène: KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KHSRP

Antigène: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Autre désignation: KHSRP (KHSRP Produits)

Synonymes: anticorps FBP2, anticorps FUBP2, anticorps KSRP, anticorps 6330409F21Rik, anticorps Fbp2, anticorps Fubp2, anticorps Ksrp, anticorps Marta1, anticorps KHSRP, anticorps VgRBP71, anticorps fbp2, anticorps ksrp, anticorps fubp2, anticorps fc94c12, anticorps wu:fb25b12, anticorps wu:fc10e10, anticorps wu:fc94c12, anticorps zgc:163038, anticorps khsrp-b, anticorps KH-type splicing regulatory protein, anticorps KH-type splicing regulatory protein L homeolog, anticorps KH-type splicing regulatory protein S homeolog, anticorps KHSRP, anticorps Khsrp, anticorps khsrp.L, anticorps khsrp, anticorps khsrp.S

Sujet: KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).

Poids moléculaire: 73 kDa (MW of target protein)