APOBEC3F anticorps (Middle Region)
-
- Antigène Voir toutes APOBEC3F Anticorps
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APOBEC3F est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ApoBEC3 F antibody was raised against the middle region of APOBEC3
- Purification
- Affinity purified
- Immunogène
- ApoBEC3 F antibody was raised using the middle region of APOBEC3 corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQ
- Top Product
- Discover our top product APOBEC3F Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ApoBEC3F Blocking Peptide, catalog no. 33R-6629, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
- Autre désignation
- ApoBEC3F (APOBEC3F Produits)
- Synonymes
- anticorps A3F, anticorps ARP8, anticorps BK150C2.4.MRNA, anticorps KA6, anticorps APOBEC3F, anticorps apolipoprotein B mRNA editing enzyme catalytic subunit 3F, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, anticorps APOBEC3F
- Sujet
- This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
- Poids moléculaire
- 45 kDa (MW of target protein)
-