DDX25 anticorps
-
- Antigène Voir toutes DDX25 Anticorps
- DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX25 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDW
- Top Product
- Discover our top product DDX25 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX25 Blocking Peptide, catalog no. 33R-1364, is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))
- Autre désignation
- DDX25 (DDX25 Produits)
- Synonymes
- anticorps DDX25, anticorps grth, anticorps xcat3, anticorps zd10a, anticorps deadsouth, anticorps GRTH, anticorps AW047046, anticorps DEAD-box helicase 25, anticorps DEAD-box helicase 25 L homeolog, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, anticorps DDX25, anticorps ddx25, anticorps ddx25.L, anticorps Ddx25
- Sujet
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX25 is a member of this family. The protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.
- Poids moléculaire
- 41 kDa (MW of target protein)
-