SRP19 anticorps (Middle Region)

N° du produit ABIN633423

Détail du produit anti-SRP19 anticorps

Antigène: SRP19 (Signal Recognition Particle 19kDa (SRP19))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRP19 est non-conjugé

Application: Western Blotting (WB)

Specificité: SRP19 antibody was raised against the middle region of SRP19

Purification: Affinity purified

Immunogène: SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRP19 Blocking Peptide, catalog no. 33R-1750, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRP19

Antigène: SRP19 (Signal Recognition Particle 19kDa (SRP19))

Autre désignation: SRP19 (SRP19 Produits)

Synonymes: anticorps 2310020D23Rik, anticorps zgc:63961, anticorps CG4457, anticorps Dmel\\CG4457, anticorps SRP19, anticorps srp19, anticorps signal recognition particle 19, anticorps signal recognition particle 19kDa L homeolog, anticorps signal recognition particle 19kDa, anticorps Signal recognition particle protein 19, anticorps SRP19, anticorps srp19.L, anticorps srp19, anticorps Srp19

Sujet: SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome