CPSF1 anticorps (Middle Region)

N° du produit ABIN633437

Détail du produit anti-CPSF1 anticorps

Antigène: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPSF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CPSF1 antibody was raised against the middle region of CPSF1

Purification: Affinity purified

Immunogène: CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPSF1 Blocking Peptide, catalog no. 33R-3195, is also available for use as a blocking control in assays to test for specificity of this CPSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPSF1

Antigène: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Autre désignation: CPSF1 (CPSF1 Produits)

Synonymes: anticorps CG10110, anticorps CPSF, anticorps CPSF-160, anticorps CPSF160, anticorps Cpsf, anticorps Dmel\\CG10110, anticorps anon-WO0118547.217, anticorps cpsf, anticorps dCPSF-160, anticorps wu:fb24c01, anticorps CPSF1, anticorps DKFZp469K0832, anticorps HSU37012, anticorps P/cl.18, anticorps ATCPSF160, anticorps K17N15.21, anticorps K17N15_21, anticorps cleavage and polyadenylation specificity factor 160, anticorps cleavage and polyadenylation specific factor 1, anticorps Cleavage and polyadenylation specificity factor 160, anticorps cleavage and polyadenylation specific factor 1 L homeolog, anticorps cleavage and polyadenylation specificity factor subunit 1, anticorps cleavage and polyadenylation specificity factor 160, anticorps Cpsf1, anticorps Cpsf160, anticorps cpsf1.L, anticorps cpsf1, anticorps CPSF1, anticorps Tsp_05366, anticorps CPSF160

Sujet: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.

Poids moléculaire: 161 kDa (MW of target protein)