SFRS9 anticorps (Middle Region)

N° du produit ABIN633457

Détail du produit anti-SFRS9 anticorps

Antigène: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS9 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRS9 antibody was raised against the middle region of SFRS9

Purification: Affinity purified

Immunogène: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS9

Antigène: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Autre désignation: SFRS9 (SFRS9 Produits)

Synonymes: anticorps SFRS9, anticorps SRp30c, anticorps 25kDa, anticorps 2610029M16Rik, anticorps Sfrs9, anticorps sfrs9, anticorps srp30c, anticorps zgc:77449, anticorps serine and arginine rich splicing factor 9, anticorps serine/arginine-rich splicing factor 9, anticorps serine/arginine-rich splicing factor 9 L homeolog, anticorps SRSF9, anticorps Srsf9, anticorps srsf9.L, anticorps srsf9

Sujet: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization