SFRS9 anticorps (Middle Region)
-
- Antigène Voir toutes SFRS9 Anticorps
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFRS9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRS9 antibody was raised against the middle region of SFRS9
- Purification
- Affinity purified
- Immunogène
- SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER
- Top Product
- Discover our top product SFRS9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
- Autre désignation
- SFRS9 (SFRS9 Produits)
- Synonymes
- anticorps SFRS9, anticorps SRp30c, anticorps 25kDa, anticorps 2610029M16Rik, anticorps Sfrs9, anticorps sfrs9, anticorps srp30c, anticorps zgc:77449, anticorps serine and arginine rich splicing factor 9, anticorps serine/arginine-rich splicing factor 9, anticorps serine/arginine-rich splicing factor 9 L homeolog, anticorps SRSF9, anticorps Srsf9, anticorps srsf9.L, anticorps srsf9
- Sujet
- SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-